Recombinant Human ACVR1B Protein (24-126), N-GST-tagged
Product Description
Cat
IMP-9175
Official Symbol
ACVR1B
Product Overview
Human ACVR1B partial ORF ( AAH00254, 24 a.a.-126 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro).
Description
Activins are dimeric growth and differentiation factors which belong to the transforming growth factor-beta (TGF-beta) superfamily of structurally related signaling proteins. Activins signal through a heteromeric complex of receptor serine kinases which include at least two type I (I and IB) and two type II (II and IIB) receptors. These receptors are all transmembrane proteins, composed of a ligand-binding extracellular domain with a cysteine-rich region, a transmembrane domain, and a cytoplasmic domain with predicted serine/threonine specificity. Type I receptors are essential for signaling, and type II receptors are required for binding ligands and for expression of type I receptors. Type I and II receptors form a stable complex after ligand binding, resulting in phosphorylation of type I receptors by type II receptors. This gene encodes activin A type IB receptor, composed of 11 exons. Alternative splicing and alternative polyadenylation result in 3 fully described transcript variants. The mRNA expression of variants 1, 2, and 3 is confirmed, and a potential fourth variant contains an alternative exon 8 and lacks exons 9 through 11, but its mRNA expression has not been confirmed.
Expression System
Wheat Germ (in vitro)
Species
Human
Tag
N-GST
Form
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass
36.96 kDa
Protein length
24-126
AA Sequence
SGPRGVQALLCACTSCLQANYTCETDGACMVSIFNLDGMEHHVRTCIPKVELVPAGKPFYCLSSEDLRNTHCCYTDYCNRIDLRVPSGHLKEPEHPSMWGPVE
Applications
ELISA; WB (Recombinant protein); Antibody Production; Protein Array
Notes
Best use within three months from the date of receipt of this protein.
Storage
Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
SDS-PAGE
Quality Control Testing

12.5% SDS-PAGE Stained with Coomassie Blue.

Data Sheet MSDS
For research or industrial raw materials, not for personal medical use!

Online Inquiry
Contact Info