Product Overview
Recombinant human Angiopoietin-like 7, fused to hIgG-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.
Description
Angiopoietin-like 7, also known as Angiopoietin-related protein 7, is a member of angiopoietin-like (ANGPTL) family. Angiopoietin-like 7 have been shown to be involved in blood vessel formation or neovascularization in several models. When overexpressed in tumor cells it promotes collagen and proteoglycan deposition but inhibits tumor xenograft progression and tumor angiogenesis. It is also expressed in the corneal stroma, trabecular meshwork, and sclera and is elevated in glaucoma aqueous humor. Overexpression of ANGPTL7 increases collagen expression. Thus, it could have a pathogenic role in glaucoma, and may serve as a potential therapeutic target.
AA Sequence
QKLSKHKTPAQPQLKAANCCEEVKELKAQVANLSSLLSELNKKQERDWVSVVMQVMELESNSKRMESRLTDAESKYSEMNNQIDIMQLQAAQTVTQTSADAIYDCSSLYQKNYRISGVYKLPPDDFLGSPELEVFCDMETSGGGWTIIQRRKSGLVSFYRDWKQYKQGFGSIRGDFWLGNEHIHRLSRQPTRLRVEMEDWEGNLRYAEYSHFVLGNELNSYRLFLGNYTGNVGNDALQYHNNTAFSTKDKDNDNCLDKCAQLRKGGYWYNCCTDSNLNGVYYRLGEHNKHLDGITWYGWHGSTYSLKRVEMKIRPEDFKP<LEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK>
