Product Overview
Recombinant human ASPA protein, fused to His-tag at N-terminus, was expressed in E. coli and purified by using conventional chromatography.
Description
ASPA, also known as aspartoacylase, is expressed in liver, lung and kidney tissue, as well as in skeletal muscle and in cerebral white matter. Existing as a homodimer, Aspartoacylase functions to catalyze the deacetylation of N-acetylaspartic acid (NAA) (a protein whose hydrolysis is crucial to maintenance of intact white matter) to produce acetate and L-aspartate.
Form
Liquid in 20mM Tris-HCl buffer (pH 8.0) containing 20% glycerol, 1mM DTT, 0.1M NaCl, 0.1mM PMSF
AA Sequence
<MGSSHHHHHHSSGLVPRGSHMGS>MTSCHIAEEHIQKVAIFGGTHGNELTGVFLVKHWLENGAEIQRTGLEVKPFITNPRAVKKCTRYIDCDLNRIFDLENLGKKMSEDLPYEVRRAQEINHLFGPKDSEDSYDIIFDLHNTTSNMGCTLILEDSRNNFLIQMFHYIKTSLAPLPCYVYLIEHPSLKYATTRSIAKYPVGIEVGPQPQGVLRADILDQMRKMIKHALDFIHHFNEGKEFPPCAIEVYKIIEKVDYPRDENGEIAAIIHPNLQDQDWKPLHPGDPMFLTLDGKTIPLGGDCTVYPVFVNEAAYYEKKEAFAKTTKLTLNAKSIRCCLH