Product Overview
Recombinant human CD14, fused to His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.
Description
CD14, also known as monocyte differentiation antigen CD14, is a member of the eucine-rich repeat (LRR) proteins family. It exists in two forms, one anchored to the membrane by a GPI-tail (mCD14), the other a soluble form (sCD14). It is a surface antigen that is preferentially expressed on monocytes/macrophages. It cooperates with other proteins to mediate the innate immune response to bacterial lipopolysaccharide(LPS). It acts as a coreceptor (along with TLR4 and MD-2) and helps to detect bacteria in the body by binding LPS, a pathogenassociated molecular pattern (PAMP).
AA Sequence
TTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIHAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLMAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSM<HHHHHH>
