IMP-7947

CD160

Human CD160 partial ORF ( AAH14465.1, 27 a.a.-136 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro).

CD160 is an 27 kDa glycoprotein which was initially identified with the monoclonal antibody BY55. Its expression is tightly associated with peripheral blood NK cells and CD8 T lymphocytes with cytolytic effector activity. The cDNA sequence of CD160 predicts a cysteine-rich, glycosylphosphatidylinositol-anchored protein of 181 amino acids with a single Ig-like domain weakly homologous to KIR2DL4 molecule. CD160 is expressed at the cell surface as a tightly disulfide-linked multimer. RNA blot analysis revealed CD160 mRNAs of 1.5 and 1.6 kb whose expression was highly restricted to circulating NK and T cells, spleen and small intestine. Within NK cells CD160 is expressed by CD56dimCD16+ cells whereas among circulating T cells its expression is mainly restricted to TCRgd bearing cells and to TCRab+CD8brightCD95+CD56+CD28-CD27-cells. In tissues, CD160 is expressed on all intestinal intraepithelial lymphocytes. CD160 shows a broad specificity for binding to both classical and nonclassical MHC class I molecules.

Wheat Germ (in vitro)

Human

N-GST

50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

37.84 kDa

27-136

INITSSASQEGTRLNLICTVWHKKEEAEGFVVFLCKDRSGDCSPETSLKQLRLKRDPGIDGVGEISSQLMFTISQVTPLHSGTYQCCARSQKSGIRLQGHFFSILFTETG

ELISA; WB (Recombinant protein); Antibody Production; Protein Array

Best use within three months from the date of receipt of this protein.

Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

12.5% SDS-PAGE Stained with Coomassie Blue.