Product Overview
Recombinant human CD3D, fused to hIgG-Histag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Description
CD3D, also known as T-cell surface glycoprotein CD3 delta chain isoform A, is a single-pass type 1 membrane protein. This protein together with CD3-gamma, CD3-epsilon and CD3-zeta, and the T-cell receptor (TCR) alpha/beta and gamma/delta heterodimers, forms the T-cell receptor-CD3 complex. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. Also, this protein plays an essential role in adaptive immune response and plays an essential role in thymocyte differentiation.
AA Sequence
FKIPIEELEDRVFVNCNTSITWVEGTVGTLLSDITRLDLGKRILDPRGIYRCNGTDIYKDKESTVQVHYRMCQSCVELDPATVA<LEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH>