Recombinant Human CD40 Protein (Full Length), Tag free
Product Description
Cat
IMP-9271
Official Symbol
CD40
Product Overview
Human CD40 full-length ORF (AAH12419.1) recombinant protein without tag was expressed in Wheat Germ (in vitro).
Description
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been found to be essential in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation. AT-hook transcription factor AKNA is reported to coordinately regulate the expression of this receptor and its ligand, which may be important for homotypic cell interactions. Adaptor protein TNFR2 interacts with this receptor and serves as a mediator of the signal transduction. The interaction of this receptor and its ligand is found to be necessary for amyloid-beta-induced microglial activation, and thus is thought to be an early event in Alzheimer disease pathogenesis. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported.
Expression System
Wheat Germ (in vitro)
Species
Human
Tag
Tag free
Form
Liquid, 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Molecular Mass
30.6 kDa
Protein length
Full Length
AA Sequence
MVRLPLQCVLWGCLLTAVHPEPPTACREKQYLINSQCCSLCQPGQKLVSDCTEFTETECLPCGESEFLDTWNRETHCHQHKYCDPNLGLRVQQKGTSETDTICTCEEGWHCTSEACESCVLHRSCSPGFGVKQIATGVSDTICEPCPVGFFSNVSSAFEKCHPWTSCETKDLVVQQAGTNKTDVVCGPQDRLRALVVIPIIFGILFAILLVLVFIKKVAKKPTNKAPHPKQEPQEINFPDDLPGSNTAAPVQETLHGCQPVTQEDGKESRISVQERQ
Applications
Antibody Production
Notes
Best use within three months from the date of receipt of this protein.
Storage
Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Data Sheet MSDS
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry
Contact Info