Product Overview
Recombinant human CD55, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Description
CD55, also known as complement decay-accelerating factor isoform 1, is a membrane protein that attaches to cell membrane via a glycophosphatidylinositol (GPI) anchor. It contains four complement control protein repeats (CCPs) with a single N-linked glycan positioned between CCPs 1 and 2. It regulates the complement system on the cell surface. It is used as a receptor by some coxsackieviruses and other enteroviruses. It is broadly distributed among hematopoietic and non-hematopoietic cells. It is a determinant for the Cromer blood group system. It plays a role promotion of tumorigenesis, decrease of complement mediated tumor cell lysis, autocrine loops for cell rescue and evasion of apoptosis, neoangiogenesis, invasiveness, cell motility.
AA Sequence
ADPDCGLPPDVPNAQPALEGRTSFPEDTVITYKCEESFVKIPGEKDSVICLKGSQWSDIEEFCNRSCEVPTRLNSASLKQPYITQNYFPVGTVVEYECRPGYRREPSLSPKLTCLQNLKWSTAVEFCKKKSCPNPGEIRNGQIDVPGGILFGATISFSCNTGYKLFGSTSSFCLISGSSVQWSDPLPECREIYCPAPPQIDNGIIQGERDHYGYRQSVTYACNKGFTMIGEHSIYCTVNNDEGEWSGPPPECRGKSLTSKVPPTVQKPTTVNVPTTEVSPTSQKTTTKTTTPNAQATRSTPVSRTTKHFHETTPNKGSGTTSHHHHHH
