Recombinant Human CD63 Protein (Full Length), Tag free
Product Description
Cat
IMP-9299
Official Symbol
CD63
Product Overview
Human CD63 full-length ORF (NP_001771.1) recombinant protein without tag was expressed in Wheat Germ (in vitro).
Description
The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. It may function as a blood platelet activation marker. Deficiency of this protein is associated with Hermansky-Pudlak syndrome. Also this gene has been associated with tumor progression. The use of alternate polyadenylation sites has been found for this gene. Alternative splicing results in multiple transcript variants encoding different proteins.
Expression System
Wheat Germ (in vitro)
Species
Human
Tag
Tag free
Form
Liquid, 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Molecular Mass
25.6 kDa
Protein length
Full Length
AA Sequence
MAVEGGMKCVKFLLYVLLLAFCACAVGLIAVGVGAQLVLSQTIIQGATPGSLLPVVIIAVGVFLFLVAFVGCCGACKENYCLMITFAIFLSLIMLVEVAAAIAGYVFRDKVMSEFNNNFRQQMENYPKNNHTASILDRMQADFKCCGAANYTDWEKIPSMSKNRVPDSCCINVTVGCGINFNEKAIHKEGCVEKIGGWLRKNVLVVAAAALGIAFVEVLGIVFACCLVKSIRSGYEVM
Applications
Antibody Production
Notes
Best use within three months from the date of receipt of this protein.
Storage
Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Data Sheet MSDS
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry
Contact Info