Product Overview
Recombinant human CD68 protein, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Description
CD68, also known as macrosialin, is a member of the lysosomal/endosomal-associated membrane glycoprotein (LAMP) family. It is expressed on monocytes/macrophages. It is found in cytoplasmic granules and in the cytoplasm of various non-hematopoietic tissues including liver and kidney tubules and glomeruli. CD68 is also found on the surface of macrophages, monocytes, neutrophils, basophils and large lymphocytes.
AA Sequence
ADPNDCPHKKSATLLPSFTVTPTVTESTGTTSHRTTKSHKTTTHRTTTTGTTSHGPTTATHNPTTTSHGNVTVHPTSNSTATSQGPSTATHSPATTSHGNATVHPTSNSTATSPGFTSSAHPEPPPPSPSPSPTSKETIGDYTWTNGSQPCVHLQAQIQIRVMYTTQGGGEAWGISVLNPNKTKVQGSCEGAHPHLLLSFPYGHLSFGFMQDLQQKVVYLSYMAVEYNVSFPHAAQWTFSAQNASLRDLQAPLGQSFSCSNSSIILSPAVHLDLLSLRLQAAQLPHTGVFGQSFSCPSDRSHHHHHH
