Product Overview
Recombinant human CD81, fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Description
CD81, also known as CD81 antigen isoform 1, belongs to the tetraspanin family. It interacts directly with immunoglobulin superfamily member 8 (IGSF8, CD316) and CD36. In B cells, it is part of a complex with CD21, CD19 and Leu13. This complex reduces the threshold for B cell activation through B cell receptors by linking Ag specific recognition and CD21 mediator recognition. On T cells it associates with CD4 and CD8 and provides a costimulatory signal with CD3.
AA Sequence
<ADP>FVNKDQIAKDVKQFYDQALQQAVVDDDANNAKAVVKTFHETLDCCGSSTLTALTTSVLKNNLCPSGSNIISNLFKEDCHQKIDDLFSGK<LEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH>