Product Overview
Recombinant human CD99, fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Description
CD99, also known as CD99 antigen isoform a, is a type 1 transmembrane glycoprotein and the founding member of the CD99 family of molecules. Cells known to express this protein include fibroblasts, neutrophils, T cells, CD34+ stem cells, monocytes and endothelial cells. Also, it plays a role in a late step of leukocyte extravasation helping leukocytes to overcome the endothelial basement membrane.
AA Sequence
ADPDGGFDLSDALPDNENKKPTAIPKKPSAGDDFDLGDAVVDGENDDPRPPNPPKPMPNPNPNHPSSSGSFSDADLADGVSGGEGKGGSDGGGSHRKEGEEADLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH