Recombinant Human CDKN2A Protein, Tag free
Product Description
Cat
IMP-7910
Official Symbol
CDKN2A
Product Overview
Human CDKN2A (P42771, 2 a.a.-156 a.a.) partial recombinant protein expressed in E. coli.
Description
This gene generates several transcript variants which differ in their first exons. At least three alternatively spliced variants encoding distinct proteins have been reported, two of which encode structurally related isoforms known to function as inhibitors of CDK4 kinase. The remaining transcript includes an alternate first exon located 20 Kb upstream of the remainder of the gene; this transcript contains an alternate open reading frame (ARF) that specifies a protein which is structurally unrelated to the products of the other variants. This ARF product functions as a stabilizer of the tumor suppressor protein p53 as it can interact with, and sequester, MDM1, a protein responsible for the degradation of p53. In spite of the structural and functional differences, the CDK inhibitor isoforms and the ARF product encoded by this gene, through the regulatory roles of CDK4 and p53 in cell cycle G1 progression, share a common functionality in cell cycle G1 control. This gene is frequently mutated or deleted in a wide variety of tumors, and is known to be an important tumor suppressor gene.
Expression System
E. coli
Species
Human
Tag
Tag free
Form
Lyophilized from PBS. Reconstitute the lyophilized powder in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0 mg/mL.
Molecular Mass
18 kDa
Protein length
2-156
AA Sequence
MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPDGYGRKKRRQRRR
Endotoxin
< 1 EU/μg of protein by LAL method
Purity
> 95% as analyzed by SDS-PAGE.
> 95% as analyzed by HPLC.
Applications
Functional Study; SDS-PAGE
Storage
Store at 4 to 8 centigrade for 1 week. For long term storage store at -20 to -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Data Sheet MSDS
For research or industrial raw materials, not for personal medical use!

Online Inquiry
Contact Info