Product Overview
Recombinant human VEGFR1/Flt-1, fused to hIgG-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.
Description
VEGFR1(Vascular endothelial growth factor receptor 1), also known as FLT-1(Fms-like tyrosine kinase 1), is belongs to the class III subfamily of receptor tyrosine kinases. While family members VEGFR1, VEGFR2and VEGFR3 are all mainly expressed on endothelial cells, only VEGFR1 is expressed on macrophages, and mainly plays inhibitory roles. Inhibitors of VEGFR are used in the treatment of cancer. It acts as a cell-surface receptor for VEGFA, VEGFB and PGF, and plays an essential role in the development of embryonic vasculature, the regulation of angiogenesis, cell survival, cell migration, macrophage function, chemotaxis, and cancer cell invasion. VEGFR1 binds VEGF with higher affinity than does VEGFR2, but shows weaker kinase activity. The VEGFkinase ligand/receptor signaling system plays a key role in vascular development and regulation of vascular permeability.
AA Sequence
SKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKESERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYSEIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEATVNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRRRIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSVHI<LEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK>
