Recombinant Human IL15 Protein (50-111 aa), GST-tagged
Product Description
Cat
IMP-6229
Official Symbol
IL15
Product Overview
Recombinant Human IL15 Protein (50-111 aa encoded by BC018149) with GST tag was expressed in E. coli, PGEX-4T.
Expression System
E. coli
Species
Human
Tag
GST
Form
The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
Protein length
50-111
AA Sequence
WVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTV
Endotoxin
Please contact the lab for more information.
Note: Remove endotoxin and sterilization is required for cell assay.
Applications
Blocking peptide
Storage
The product is shipped at ambient temperature.
Store for up to 12 months at -20 to -80 centigrade as lyophilized powder.
Storage of Reconstituted Protein:
Short-term storage: Store at 2-8 centigrade for (1-2 weeks).
Long-term storage: Aliquot and store at -20 to -80 centigrade for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
Reconstitution
Reconstitute at 0.25 μg/μL in 200 μL sterile water for short-term storage.
Reconstitution with 200 μL 50% glycerol solution is recommended for longer term storage (see Stability and Storage for more details).
If a different concentration is needed for your purposes please adjust the reconstitution volume as required (please note: the ion concentration of the final solution will vary according to the volume used).
Note: Centrifuge vial before opening. When reconstituting, gently pipet and wash down the sides of the vial to ensure full recovery of the protein into solution.
Data Sheet MSDS
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry
Contact Info