Recombinant Human IL15 Protein, Tag free
Product Description
Cat
IMP-8485
Official Symbol
IL15
Product Overview
Human IL15 (P40933) recombinant protein expressed in E. coli.
Description
The protein encoded by this gene is a cytokine that regulates T and natural killer cell activation and proliferation. This cytokine and interleukine 2 share many biological activities. They are found to bind common hematopoietin receptor subunits, and may compete for the same receptor, and thus negatively regulate each other's activity. The number of CD8+ memory cells is shown to be controlled by a balance between this cytokine and IL2. This cytokine induces the activation of JAK kinases, as well as the phosphorylation and activation of transcription activators STAT3, STAT5, and STAT6. Studies of the mouse counterpart suggested that this cytokine may increase the expression of apoptosis inhibitor BCL2L1/BCL-x(L), possibly through the transcription activation activity of STAT6, and thus prevent apoptosis. Two alternatively spliced transcript variants of this gene encoding the same protein have been reported.
Expression System
E. coli
Species
Human
Tag
Tag free
Form
Lyophilized from a 5 mM Tris, pH 8.0
Molecular Mass
12.8 kDa
AA Sequence
MNWVNVISDLKKIEDLIQSMHIDATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIHDTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFLQSFVHIVQMFINTS
Endotoxin
< 0.1 EU/μg
Applications
Functional Study; SDS-PAGE
Storage
Store at -20 centigrade on dry atmosphere. After reconstitution with sterilized water, store at -20 centigrade or lower. Aliquot to avoid repeated freezing and thawing.
Data Sheet MSDS
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry
Contact Info