Recombinant Human IL1B Protein, Tag Free
Product Description
Cat
IMP-7108
Official Symbol
Il1b
Product Overview
Recombinant Human Interleukin-1beta without tag was expressed in E. coli.
Result by N-terminal sequencing: APVRSL and MAPVRS
Description
The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. Similarly, IL-1B has been implicated in human osteoarthritis pathogenesis. Patients with severe Coronavirus Disease 2019 (COVID-19) present elevated levels of pro-inflammatory cytokines such as IL-1B in bronchial alveolar lavage fluid samples. The lung damage induced by the Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is to a large extent, a result of the inflammatory response promoted by cytokines such as IL-1B. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. [provided by RefSeq, Jul 2020]
Expression System
E. coli
Species
Human
Tag
Tag free
Form
Presentation State: Purified
State: Lyophilized purified protein
Buffer System: PBS
Molecular Mass
17 kDa
AA Sequence
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQANMPVFLGGTKGGQDITDFTMQFVSS
Purity
> 98% pure by SDS-PAGE and Silver stain
Notes
Range: 0.1-10.0 ng/ml
Storage
Store lyophilized at RT for 3 weeks or (preferably in a desiccator) at -20 centigrade for longer. Following reconstitution store the antibody undiluted at 2-8 centigrade for one week or (in aliquots) at -20 centigrade for longer. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Reconstitution
The lyophilized rh IL-1beta is soluble in water and most aqueous buffers. The lyophilized powder can be restored in water to a concentration of 0.1 mg/mL. This solution can be diluted into other buffered solutions or stored at -20 centigrade for future use.
SDS-PAGE
SDS-PAGE

Data Sheet MSDS
For research or industrial raw materials, not for personal medical use!

Online Inquiry
Contact Info