Recombinant Human IL1B Protein, Tag Free
Product Description
Cat
IMP-7108
Official Symbol
Il1b
Product Overview
Recombinant Human Interleukin-1beta without tag was expressed in E. coli.
Result by N-terminal sequencing: APVRSL and MAPVRS
Description
The protein encoded by this gene is a member of the interleukin 1 cytokine family. This cytokine is produced by activated macrophages as a proprotein, which is proteolytically processed to its active form by caspase 1 (CASP1/ICE). This cytokine is an important mediator of the inflammatory response, and is involved in a variety of cellular activities, including cell proliferation, differentiation, and apoptosis. The induction of cyclooxygenase-2 (PTGS2/COX2) by this cytokine in the central nervous system (CNS) is found to contribute to inflammatory pain hypersensitivity. Similarly, IL-1B has been implicated in human osteoarthritis pathogenesis. Patients with severe Coronavirus Disease 2019 (COVID-19) present elevated levels of pro-inflammatory cytokines such as IL-1B in bronchial alveolar lavage fluid samples. The lung damage induced by the Severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) is to a large extent, a result of the inflammatory response promoted by cytokines such as IL-1B. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. [provided by RefSeq, Jul 2020]
Expression System
E. coli
Species
Human
Tag
Tag free
Form
Presentation State: Purified
State: Lyophilized purified protein
Buffer System: PBS
Molecular Mass
17 kDa
AA Sequence
APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQANMPVFLGGTKGGQDITDFTMQFVSS
Purity
> 98% pure by SDS-PAGE and Silver stain
Notes
Range: 0.1-10.0 ng/ml
Storage
Store lyophilized at RT for 3 weeks or (preferably in a desiccator) at -20 centigrade for longer. Following reconstitution store the antibody undiluted at 2-8 centigrade for one week or (in aliquots) at -20 centigrade for longer. For long term storage it is recommended to add a carrier protein (0.1% HSA or BSA). Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Reconstitution
The lyophilized rh IL-1beta is soluble in water and most aqueous buffers. The lyophilized powder can be restored in water to a concentration of 0.1 mg/mL. This solution can be diluted into other buffered solutions or stored at -20 centigrade for future use.
SDS-PAGE
SDS-PAGE

Data Sheet MSDS
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry
Contact Info