Recombinant Human IL4 Protein (25-153), His-tagged
Product Description
Cat
IMP-6717
Official Symbol
IL4
Product Overview
Recombinant human Interleukin-4/IL4 (25-153) protein with His tag was expressed in E. coli.
Description
The protein encoded by this gene is a pleiotropic cytokine produced by activated T cells. This cytokine is a ligand for interleukin 4 receptor. The interleukin 4 receptor also binds to IL13, which may contribute to many overlapping functions of this cytokine and IL13. STAT6, a signal transducer and activator of transcription, has been shown to play a central role in mediating the immune regulatory signal of this cytokine. This gene, IL3, IL5, IL13, and CSF2 form a cytokine gene cluster on chromosome 5q, with this gene particularly close to IL13. This gene, IL13 and IL5 are found to be regulated coordinately by several long-range regulatory elements in an over 120 kilobase range on the chromosome. IL4 is considered an important cytokine for tissue repair, counterbalancing the effects of proinflammatory type 1 cytokines, however, it also promotes allergic airway inflammation. Moreover, IL-4, a type 2 cytokine, mediates and regulates a variety of human host responses such as allergic, anti-parasitic, wound healing, and acute inflammation. This cytokine has been reported to promote resolution of neutrophil-mediated acute lung injury. In an allergic response, IL-4 has an essential role in the production of allergen-specific immunoglobin (Ig) E. This pro-inflammatory cytokine has been observed to be increased in COVID-19 (Coronavirus disease 2019) patients, but is not necessarily associated with severe COVID-19 pathology. Two alternatively spliced transcript variants of this gene encoding distinct isoforms have been reported. [provided by RefSeq, Aug 2020]
Expression System
E. coli
Species
Human
Tag
His
Form
Presentation State: Purified
State: Liquid purified protein
Buffer System: 20 mM Tris-HCl buffer (pH 8.0) containing 10% glycerol
Molecular Mass
17.2 kDa
Protein length
25-153
AA Sequence
MGSSHHHHHHSSGLVPRGSHMHKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTEKETFCRAATVLRQFYSHHEKDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNSCPVKEANQSTLENFLERLKTIMREKYSKCSS
Endotoxin
< 1.0 EU/μg protein as determined by the LAL method
Purity
> 95% by SDS-PAGE.
Storage
Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer. Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Concentration
lot specific
SDS-PAGE
SDS-PAGE

Data Sheet MSDS
For research or industrial raw materials, not for personal medical use!

Online Inquiry
Contact Info