Product Overview
Recombinant human IL-6R alpha, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Description
IL-6R alpha, also known as interleukin-6 receptor subunit alpha isoform 1, is a type I cytokine receptor. It is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in immune response. It has a modular build of several immunoglobulin-like and fibronectin type III-like domains. The low concentration of a soluble form of IL-6 receptor (sIL-6R) acts as an agonist of IL-6 activity. In the IL6R/CD126/IL6R system, both a membrane-bound IL-6R and a sIL-6R protein are able to mediate IL-6 signals into the cells through the interaction of gp130. It is implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer.
AA Sequence
<ADP>LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQDSSSVPLP<HHHHHH>
