Recombinant Human KIR2DL3 Protein, Tag Free
Product Description
Cat
IMP-7148
Official Symbol
KIR2DL3
Product Overview
Recombinant Human KIR2DL3 Protein without tag was expressed in E. coli.
Description
Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response.
Expression System
E. coli
Species
Human
Tag
Tag free
Form
Presentation State: Purified
State: Liquid protein
Buffer System: 20 mM Tris-HCl buffer (pH7.5)
Molecular Mass
22.2 kDa
AA Sequence
MEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGISKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGN
Purity
> 95% by SDS-PAGE.
Storage
Store at 2-8 centigrade for up to one month or (in aliquots) at -20 centigrade. Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Concentration
lot specific
SDS-PAGE
SDS-PAGE

Data Sheet MSDS
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry
Contact Info