Product Overview
Recombinant human KIR2DL4 protein, fused to hIgG-Histag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Description
KIR2DL4, also known as killer cell immunoglobulin-like receptor 2DL4, is a member of the killer cell Ig-like receptor (KIR) family. KIR proteins with the long cytoplasmic domain transduce inhibitory signals via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. This protein induces NK cells to produce IFN-gamma and stimulation with IL-2 upregulates cell surface expression on CD56dim cells and leads to the inhibition of the cytolytic NK cell function.
AA Sequence
HVGGQDKPFCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKPSLTARPGPTVRAGENVTLSCSSQSSFDIYHLSREGEAHELRLPAVPSINGTFQADFPLGPATHGETYRCFGSFHGSPYEWSDPSDPLPVSVTGNPSSSWPSPTEPSFKTGIARHLHLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
