Recombinant Human KIR2DL4 Protein (32-126), N-GST-tagged
Product Description
Cat
IMP-8535
Official Symbol
KIR2DL4
Product Overview
Human KIR2DL4 partial ORF ( NP_002246, 32 a.a.-126 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro).
Description
Killer cell immunoglobulin-like receptors (KIRs) are transmembrane glycoproteins expressed by natural killer cells and subsets of T cells. The KIR genes are polymorphic and highly homologous and they are found in a cluster on chromosome 19q13.4 within the 1 Mb leukocyte receptor complex (LRC). The gene content of the KIR gene cluster varies among haplotypes, although several "framework" genes are found in all haplotypes (KIR3DL3, KIR3DP1, KIR3DL4, KIR3DL2). The KIR proteins are classified by the number of extracellular immunoglobulin domains (2D or 3D) and by whether they have a long (L) or short (S) cytoplasmic domain. KIR proteins with the long cytoplasmic domain transduce inhibitory signals upon ligand binding via an immune tyrosine-based inhibitory motif (ITIM), while KIR proteins with the short cytoplasmic domain lack the ITIM motif and instead associate with the TYRO protein tyrosine kinase binding protein to transduce activating signals. The ligands for several KIR proteins are subsets of HLA class I molecules; thus, KIR proteins are thought to play an important role in regulation of the immune response. This gene is one of the "framework" loci that is present on all haplotypes. Alternative splicing results in multiple transcript variants.
Expression System
Wheat Germ (in vitro)
Species
Human
Tag
N-GST
Form
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass
36.19 kDa
Protein length
32-126
AA Sequence
FCSAWPSAVVPQGGHVTLRCHYRRGFNIFTLYKKDGVPVPELYNRIFWNSFLISPVTPAHAGTYRCRGFHPHSPTEWSAPSNPLVIMVTGLYEKP
Applications
ELISA; WB (Recombinant protein); Antibody Production; Protein Array
Notes
Best use within three months from the date of receipt of this protein.
Storage
Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
SDS-PAGE
Quality Control Testing

12.5% SDS-PAGE Stained with Coomassie Blue.

Data Sheet MSDS
For research or industrial raw materials, not for personal medical use!

Online Inquiry
Contact Info