Product Overview
Recombinant human NECTIN2, fused to His-tag at Cterminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Description
NECTIN2, also known as nectin-2 isoform delta, is a Ca (2+) -independent cell-cell adhesion molecule that is one of the plasma membrane components of adherens junctions. It is a key player for the establishment of homotypic and heterotypic cell to cell contacts. It is required for exerting the resistance against herpes simplex virus type 2 infection in transfected cells. It is a potential target for antibody therapy of breast and ovarian cancers. It might be associated with human longevity.
AA Sequence
QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPNTAGAGATGGLEHHHHHH