Product Overview
Recombinant human PVR, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Description
PVR, also known as poliovirus receptor isoform alpha, is a Type I transmembrane glycoprotein in the immunoglobulin superfamily. It catalyzes a large structural change in the virus that exposes membrane-binding protein chains. It plays an important regulatory role in helper T cell differentiation and allergic diseases. It is expressed in many types of human cells and has diverse functions. It may be potentially useful as a biomarker for cancer development and progression. It may play a critical role through both immunological and non-immuno logical mechanisms in pancreatic cancer.
AA Sequence
WPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTHVSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGNYTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWHSDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTVYYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIRPVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGMSRNLEHHHHHH
