Product Overview
Recombinant human RAET1E, fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Description
RAET1E, also known as NKG2D ligand 4 isoform 1, is a member of the RAET1/ULBP family of cell surface protein that function as ligands for NKG2D. This protein is abnormally expressed on most colon cancer and some other tumor cell lines and virus infected peripheral blood cells. It binds and co-stimulates NKG2D expressing effector cells including NK cells, NKT cells, gamma delta T cells, and CD8+ alpha beta T cells, activating cytolytic activity and/or cytokine production. Also, it functions as a stress-induced ligand for NKG2D receptor.
AA Sequence
ADPHSLCFNFTIKSLSRPGQPWCEAQVFLNKNLFLQYNSDNNMVKPLGLLGKKVYATSTWGELTQTLGEVGRDLRMLLCDIKPQIKTSDPSTLQVEMFCQREAERCTGASWQFATNGEKSLLFDAMNMTWTVINHEASKIKETWKKDRGLEKYFRKLSKGDCDHWLREFLGHWEAMPEPTVSPVNASDIHWSSSSLPDVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH