Product Overview
Recombinant human TGFBR1, fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Description
TGFBR1, also known as TGF-beta receptor type-1 isoform 1, is a single-pass type 1 membrane protein which belongs to the protein kinase superfamily and TGFB receptor subfamily. This protein is a secreted protein that performs many cellular functions, including the control of cell growth, cell proliferation, cell differentiation and apoptosis. Also, it plays an important role in controlling the immune system, and shows different activities on different types of cell, or cells at different developmental stages. Defects in TGFBR1 are the cause of Loeys-Dietz syndrome type 1A (LDS1A), Loeys-Diets syndrome type 2A (LDS2A), and aortic aneurysm familial thoracic type 5 (AAT5).
AA Sequence
<ADL>LLPGATALQCFCHLCTKDNFTCVTDGLCFVSVTETTDKVIHNSMCIAEIDLIPRDRPFVCAPSSKTGSVTTTYCCNQDHCNKIELPTTVKSSPGLGPVEL<VEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH>
