Product Overview
Recombinant human TGFBR2, fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Description
TGFBR2, as known as TGF-beta receptor type-2 isoform B, is a member of the serine and threonine protein kinase family and the TGF beta receptor subfamily. The type-2 receptor binds TGF-beta1 and TGF-beta3 with high affinity, and TGF-beta2 with a much lower affinity. It forms a heterodimeric complex with type1 receptor and is essential for signal transduction. Also, this protein may play an important role in TGF-beta2 binding and signaling in cells lacking TGFBR3.
AA Sequence
TIPPHVQKSVNNDMIVTDNNGAVKFPQLCKFCDVRFSTCDNQKSCMSNCSITSICEKPQEVCVAVWRKNDENITLETVCHDPKLPYHDFILEDAASPKCIMKEKKKPGETFFMCSCSSDECNDNIIFSEEYNTSNPDLLLVIFQ<LEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH>
