Product Overview
Recombinant human TNFRSF14, fused to hIgG-His-tag at Cterminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Description
TNFRSF14, as known as tumor necrosis factor receptor superfamily member 14 isoform 1, is a type 1 membrane protein belonging to the TNF/NGF receptor superfamily. Expression of this protein has been detected in peripheral blood T cells, B cells, monocytes and in various tissue enriched in lymphoid cells. Binding of herpes simplex virus (HSV) viral envelope glycoprotein D to this receptor protein has been shown to be part of HSV entry mechanism, and from which its name derived.
AA Sequence
ADPLPSCKEDEYPVGSECCPKCSPGYRVKEACGELTGTVCEPCPPGTYIAHLNGLSKCLQCQMCDPAMGLRASRNCSRTENAVCGCSPGHFCIVQDGDHCAACRAYATSSPGQRVQKGGTESQDTLCQNCPPGTFSPNGTLEECQHQTKCSWLVTKAGAGTSSSHWVLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
