Product Overview
Recombinant human TNFRSF17, fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Description
TNFRSF17, also known as tumor necrosis factor receptor superfamily member 17, is a member of the TNF receptor superfamily. It is a receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL and promotes B-cell survival and plays a role in the regulation of humoral immunity. It activates NF-kappa-B and JNK.
AA Sequence
<ADP>MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA<LEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH>