Product Overview
Recombinant human TNFRSF18, fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Description
TNFRSF18, also known as tumor necrosis factor receptor superfamily member 18 isoform 1, is receptor for TNFSF18. It seems to be involved in interactions between activated T-lymphocytes and endothelial cells and in the regulation of T-cell receptor-mediated cell death. TNFRSF18 mediated NF-kappa-B activation via the TRAF2/NIK pathway. Also, this protein reciprocally stimulated and activate intracellular signals regulating immune functions. In particular, GITR-driven T-cell co-stimulation was found to be the main mechanism by which the GITRL-GITR system contributes to tumor rejection and the development of autoimmune/inflammatory diseases.
AA Sequence
QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAEPLEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH
