Recombinant Human TNFRSF1A Protein, Tag free

Product Description

Cat

IMP-8961

Official Symbol

TNFRSF1A

Product Overview

Human TNFRSF1A recombinant protein expressed in E. coli.

Description

The protein encoded by this gene is a member of the TNF-receptor superfamily. This protein is one of the major receptors for the tumor necrosis factor-alpha. This receptor can activate NF-kappaB, mediate apoptosis, and function as a regulator of inflammation. Antiapoptotic protein BCL2-associated athanogene 4 (BAG4/SODD) and adaptor proteins TRADD and TRAF2 have been shown to interact with this receptor, and thus play regulatory roles in the signal transduction mediated by the receptor. Germline mutations of the extracellular domains of this receptor were found to be associated with the autosomal dominant periodic fever syndrome. The impaired receptor clearance is thought to be a mechanism of the disease.

Expression System

E. coli

Species

Human

Tag

Tag free

Form

Lyophilized with 10 mM Na2PO4, pH 7.5.

Molecular Mass

20.9 kDa

AA Sequence

MDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIEN

Endotoxin

< 0.1 EU/μg

Applications

Functional Study; SDS-PAGE

Storage

Store at -20 centigrade on dry atmosphere. After reconstitution with sterilized water, store at -20 centigrade. Aliquot to avoid repeated freezing and thawing.

SDS-PAGE

1 μg/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue Lane 1: non-reducing conditions Lane 2: reducing conditions

Bioactivity-ELISA 1

929 cells were cultured with 1 ng/mL human TNF and 1 μg/mL Actinomycin D, plus serial dilutions of human TNFRSF1A from 0-10 μg/mL. Cell proliferation was measured after 24 hours and the linear portion of the curve was us used to calculate the ED50.

Data Sheet MSDS

Datasheet MSDS

For research or industrial raw materials, not for personal medical use!

Online Inquiry