Description
The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB through its interaction with adaptor proteins TRAF2 and TRAF5. Knockout studies in mice suggested that this receptor promotes the expression of apoptosis inhibitors BCL2 and BCL2lL1/BCL2-XL, and thus suppresses apoptosis. The knockout studies also suggested the roles of this receptor in CD4+ T cell response, as well as in T cell-dependent B cell proliferation and differentiation.
Form
Liquid, In 50 mM sodium phosphate, 100 mM NaCl, pH 7.6. (0.5 mg/mL gentamicin sulfate)
AA Sequence
TNFRSF4 mature: lhcvgdtypsndrcchecrpgngmvsrcsrsqntvcrpcgpgfyndvvsskpckpctwcnlrsgserkqlctatqdtvcrcragtqpldsykpgvdcapcppghfspgdnqackpwtnctlagkhtlqpasnssdaicedrdppatqpqetqgpparpitvqpteawprtsqgpstr<br>Fused to murine IgG2a Fc: eprgptikpcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnvevhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkgsvrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsdgsyfmysklrvekknwvernsyscsvvheglhnhhttksfsrtpg