Product Overview
Recombinant human TNFRSF8, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Description
TNFRSF8, also known as Tumor necrosis factor receptor superfamily member 8, is receptor for TNFSF8/CD30L. It may play a role in the regulation of cellular growth and transformation of activated lymphoblasts. Also, this protein regulates gene expression through activation of NF-kappa-B. As a regulator of apoptosis, TNFRSF8 induces cell death or proliferation, depending on the cell type.
AA Sequence
<ADP>FPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPMGLFPTQQCPQRPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCSTSAVNSCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPTPVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDCRKQCEPDYYLDEAGRCTACVSCSRDDLVEKTPCAWNSSRTCECRPGMICATSATNSCARCVPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPENGEAPASTSPTQSLLVDSQASKTLPIPTSAPVALSSTGK<HHHHHH>