Recombinant Human TNFSF11 Protein (1-244), N-GST-tagged
Product Description
Cat
IMP-9088
Official Symbol
TNFSF11
Product Overview
Human TNFSF11 full-length ORF ( ENSP00000351347, 1 a.a.-244 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro).
Description
This gene encodes a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. This protein was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. This protein was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis. Targeted disruption of the related gene in mice led to severe osteopetrosis and a lack of osteoclasts. The deficient mice exhibited defects in early differentiation of T and B lymphocytes, and failed to form lobulo-alveolar mammary structures during pregnancy. Two alternatively spliced transcript variants have been found.
Expression System
Wheat Germ (in vitro)
Species
Human
Tag
N-GST
Form
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Molecular Mass
54.1 kDa
Protein length
1-244
AA Sequence
MDPNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIKQAFQGAVQKELQHIVGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
Applications
ELISA; WB (Recombinant protein); Antibody Production; Protein Array
Notes
Best use within three months from the date of receipt of this protein.
Storage
Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
SDS-PAGE
Quality Control Testing

12.5% SDS-PAGE Stained with Coomassie Blue.

Data Sheet MSDS
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry
Contact Info