IMP-9090

TNFSF11

Human TNFSF11 recombinant protein with polyhistidine tag at the C-terminus expressed in E. coli.

This gene encodes a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. This protein was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. This protein was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis. Targeted disruption of the related gene in mice led to severe osteopetrosis and a lack of osteoclasts. The deficient mice exhibited defects in early differentiation of T and B lymphocytes, and failed to form lobulo-alveolar mammary structures during pregnancy. Two alternatively spliced transcript variants have been found.

E. coli

Human

C-His

Lyophilized from a solution containing 1X PBS, pH 8.0. Reconstitute the lyophilized powder in ddH2O to 100 μg/mL.

MEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID with polyhistidine tag at the C-terminus.

< 0.1 EU/μg of protein by the LAL method.

> 98% by SDS-PAGE

Functional Study; SDS-PAGE

Lyophilized protein should be stored at -20 centigrade. Protein aliquots should be stored at-20 to -80 centigrade. This product is stable for one year. Avoid repeated freeze/thaw cycles.

SDS-PAGE Stained with Coomassie Blue. SDS-PAGE analysis of TNFSF11 (Human) Recombinant Protein.