Recombinant Human TNFSF11 Protein, Tag free
Product Description
Cat
IMP-9087
Official Symbol
TNFSF11
Product Overview
Human TNFSF11 (O14788) recombinant protein expressed in E. coli.
Description
This gene encodes a member of the tumor necrosis factor (TNF) cytokine family which is a ligand for osteoprotegerin and functions as a key factor for osteoclast differentiation and activation. This protein was shown to be a dentritic cell survival factor and is involved in the regulation of T cell-dependent immune response. T cell activation was reported to induce expression of this gene and lead to an increase of osteoclastogenesis and bone loss. This protein was shown to activate antiapoptotic kinase AKT/PKB through a signaling complex involving SRC kinase and tumor necrosis factor receptor-associated factor (TRAF) 6, which indicated this protein may have a role in the regulation of cell apoptosis. Targeted disruption of the related gene in mice led to severe osteopetrosis and a lack of osteoclasts. The deficient mice exhibited defects in early differentiation of T and B lymphocytes, and failed to form lobulo-alveolar mammary structures during pregnancy. Two alternatively spliced transcript variants have been found.
Expression System
E. coli
Species
Human
Tag
Tag free
Form
Lyophilized from 10 mM Na2PO4, pH 8.0
Molecular Mass
20 kDa
AA Sequence
EKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSHKVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMVYVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLDPDQDATYFGAFKVRDID
Endotoxin
< 0.1 EU/μg
Applications
Functional Study; SDS-PAGE
Storage
Store at -20 centigrade on dry atmosphere. After reconstitution with sterilized water, store at -20 centigrade or lower. Aliquot to avoid repeated freezing and thawing.
SDS-PAGE
Quality Control Testing

1 μg/lane in 4-20% Tris-Glycine gel Stained with Coomassie Blue Lane 1: non-reducing conditions Lane 2: reducing conditions

Bioactivity-ELISA 1
Result of activity analysis

Human PBMCs were cultured with 0 to 1000 ng/mL human TNFSF11. Human IL8 production was measured after 48 hours and the linear portion of the curve was us used to calculate the ED50.

Data Sheet MSDS
For research or industrial raw materials, not for personal medical use!

Online Inquiry
Contact Info