Recombinant Human TNFSF14 Protein (Full Length), Tag free
Product Description
Cat
IMP-9103
Official Symbol
TNFSF14
Product Overview
Human TNFSF14 full-length ORF (NP_742011.1) recombinant protein without tag was expressed in Wheat Germ (in vitro).
Description
The protein encoded by this gene is a member of the tumor necrosis factor (TNF) ligand family. This protein is a ligand for TNFRSF14, which is a member of the tumor necrosis factor receptor superfamily, and which is also known as a herpesvirus entry mediator (HVEM). This protein may function as a costimulatory factor for the activation of lymphoid cells and as a deterrent to infection by herpesvirus. This protein has been shown to stimulate the proliferation of T cells, and trigger apoptosis of various tumor cells. This protein is also reported to prevent tumor necrosis factor alpha mediated apoptosis in primary hepatocyte. Two alternatively spliced transcript variant encoding distinct isoforms have been reported.
Expression System
Wheat Germ (in vitro)
Species
Human
Tag
Tag free
Form
Liquid, 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Molecular Mass
22.4 kDa
Protein length
Full Length
AA Sequence
MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEEVVVRVLDERLVRLRDGTRSYFGAFMV
Applications
Antibody Production
Notes
Best use within three months from the date of receipt of this protein.
Storage
Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Data Sheet MSDS
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry
Contact Info