Recombinant Human TNFSF8 Protein, Tag Free
Product Description
Cat
IMP-7853
Official Symbol
TNFSF8
Product Overview
Recombinant human CD153 / CD30L protein without tag was produced in CHO.
Description
The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This cytokine is a ligand for TNFRSF8/CD30, which is a cell surface antigen and a marker for Hodgkin lymphoma and related hematologic malignancies. The engagement of this cytokine expressed on B cell surface plays an inhibitory role in modulating Ig class switch. This cytokine was shown to enhance cell proliferation of some lymphoma cell lines, while to induce cell death and reduce cell proliferation of other lymphoma cell lines. The pleiotropic biologic activities of this cytokine on different CD30+ lymphoma cell lines may play a pathophysiologic role in Hodgkin's and some non-Hodgkin's lymphomas. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]
Expression System
CHO
Species
Human
Tag
Tag free
Form
Presentation State: Purified
State: Lyophilized purified protein
Buffer System: PBS without stabilizers
Molecular Mass
21.3 kDa
AA Sequence
HHHHHHHHPSPGGSGGQRTDSIPNSPDNVPLKGGNCSEDLLCILKRAPFKKSWAYLQVAKHLNKTKLSWNKDGILHGVRYQDGNLVIQFPGLYFIICQLQFLVQCPNNSVDLKLELLINKHIKKQALVTVCESGMQTKHVYQNLSQFLLDYLQVNTTISVNVDTFQYIDTSTFPLENVLSIFLYSNSD
Purity
> 98% by SDS-PAGE and HPLC analyses.
Notes
Centrifuge the vial prior to opening!
Storage
Store lyophilized at 2-8 centigrade for 6 months or at -20 centigrade long term. After reconstitution store the antibody undiluted at 2-8 centigrade for one month or (in aliquots) at -20 centigrade long term. Avoid repeated freezing and thawing.
Shelf life: one year from despatch.
Reconstitution
Restore in water to a concentration of 0.1-1.0 mg/mL. This solution can be diluted into other aqueous buffers and stored at 4 centigrade for one week or at -20 centigrade for future use.
Data Sheet MSDS
For research or industrial raw materials, not for personal medical use!

Online Inquiry
Contact Info