IMP-7855

Tnfsf9

Recombinant Human 4-1BBL/TNFSF9 (71-254) protein with a His tag was expressed in E. coli.

The protein encoded by this gene is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. This transmembrane cytokine is a bidirectional signal transducer that acts as a ligand for TNFRSF9/4-1BB, which is a costimulatory receptor molecule in T lymphocytes. This cytokine and its receptor are involved in the antigen presentation process and in the generation of cytotoxic T cells. The receptor TNFRSF9/4-1BB is absent from resting T lymphocytes but rapidly expressed upon antigenic stimulation. The ligand encoded by this gene, TNFSF9/4-1BBL, has been shown to reactivate anergic T lymphocytes in addition to promoting T lymphocyte proliferation. This cytokine has also been shown to be required for the optimal CD8 responses in CD8 T cells. This cytokine is expressed in carcinoma cell lines, and is thought to be involved in T cell-tumor cell interaction.[provided by RefSeq, Oct 2008]

E. coli

Human

His

Presentation State: Purified
State: Liquid purified IgG
Buffer System: 20 mM Tris-HCl buffer (pH 8.0) containing 100 mM NaCl, 20% glycerol

23.8 kDa

MRGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSHMREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE

> 95% by SDS-PAGE.

Store undiluted at 2-8 centigrade for up to two weeks or (in aliquots) at -20 or -70 centigrade for longer. Avoid repeated freezing and thawing.
Shelf life: one year from despatch.

lot specific