IMP-8983

TRAF6

Human TRAF6 partial ORF ( AAH31052, 413 a.a.-522 a.a.) recombinant protein with GST-tag at N-terminal was expressed in Wheat Germ (in vitro).

The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. This protein mediates the signaling not only from the members of the TNF receptor superfamily, but also from the members of the Toll/IL-1 family. Signals from receptors such as CD40, TNFSF11/RANCE and IL-1 have been shown to be mediated by this protein. This protein also interacts with various protein kinases including IRAK1/IRAK, SRC and PKCzeta, which provides a link between distinct signaling pathways. This protein functions as a signal transducer in the NF-kappaB pathway that activates IkappaB kinase (IKK) in response to proinflammatory cytokines. The interaction of this protein with UBE2N/UBC13, and UBE2V1/UEV1A, which are ubiquitin conjugating enzymes catalyzing the formation of polyubiquitin chains, has been found to be required for IKK activation by this protein. Two alternatively spliced transcript variants encoding identical proteins have been reported.

Wheat Germ (in vitro)

Human

N-GST

50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

37.84 kDa

413-522

TMQGEYDSHLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKDDTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV

ELISA; WB (Recombinant protein); Antibody Production; Protein Array

Best use within three months from the date of receipt of this protein.

Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.

12.5% SDS-PAGE Stained with Coomassie Blue.