IMP-9021

VEGFA

Human VEGFA (VEGF165) recombinant protein with polyhistidine tag at the C-terminus expressed in E. coli.

This gene is a member of the PDGF/VEGF growth factor family and encodes a protein that is often found as a disulfide linked homodimer. This protein is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis and endothelial cell growth, promoting cell migration, and inhibiting apoptosis. Elevated levels of this protein is linked to POEMS syndrome, also known as Crow-Fukase syndrome. Mutations in this gene have been associated with proliferative and nonproliferative diabetic retinopathy. Alternatively spliced transcript variants, encoding either freely secreted or cell-associated isoforms, have been characterized. There is also evidence for the use of non-AUG (CUG) translation initiation sites upstream of, and in-frame with the first AUG, leading to additional isoforms.

E. coli

Human

C-His

Lyophilized from a solution containing 1X PBS, pH 8.0. Reconstitute the lyophilized powder in ddH2O to 100 μg/mL.

MAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR with polyhistidine tag at the C-terminus.

< 0.1 EU/μg of protein by the LAL method.

> 98% by SDS-PAGE

Functional Study; SDS-PAGE

Lyophilized protein should be stored at -20 centigrade. Protein aliquots should be stored at-20 to -80 centigrade. This product is stable for one year. Avoid repeated freeze/thaw cycles.

SDS-PAGE Stained with Coomassie Blue. SDS-PAGE analysis of VEGFA (Human) Recombinant Protein.