Recombinant Human VEGFA Protein, Tag free
Product Description
Cat
IMP-9016
Official Symbol
VEGFA
Product Overview
Human VEGFA (P15692-4) recombinant protein expressed in E. coli.
Description
This gene is a member of the PDGF/VEGF growth factor family and encodes a protein that is often found as a disulfide linked homodimer. This protein is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis and endothelial cell growth, promoting cell migration, and inhibiting apoptosis. Elevated levels of this protein is linked to POEMS syndrome, also known as Crow-Fukase syndrome. Mutations in this gene have been associated with proliferative and nonproliferative diabetic retinopathy. Alternatively spliced transcript variants, encoding either freely secreted or cell-associated isoforms, have been characterized. There is also evidence for the use of non-AUG (CUG) translation initiation sites upstream of, and in-frame with the first AUG, leading to additional isoforms.
Expression System
E. coli
Species
Human
Tag
Tag free
Form
Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA).
Molecular Mass
19.3/38.6 kDa
AA Sequence
MAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Endotoxin
≤ 1 EUs/μg (Kinetic LAL)
Purity
≥ 95%
Applications
WB; Functional Study
Storage
Storage Prior to Reconstitution: -20 centigrade. Stored at -20 to -80 centigrade for 12 month. After reconstitution with sterile water at 0.1 mg/mL, store at -20 to -80 centigrade for 3 months, store at 4 centigrade for 1 month. Aliquot to avoid repeated freezing and thawing.
Bioactivity-ELISA 1
Result of activity analysis

Data Sheet MSDS
For Research Use Only. Not intended for any clinical use. No products from Creative BioMart may be resold, modified for resale or used to manufacture commercial products without prior written approval from Creative BioMart.

Online Inquiry
Contact Info