Product Overview
Recombinant mouse BTLA, fused to hIgG-His-tag at C-terminus, was expressed in HEK293 cell and purified by using conventional chromatography techniques.
Description
BTLA, also known as B- and T-lymphocyte attenuator isoform 1, is an inhibitory molecule which belongs to the Ig superfamily. It is a type 1 transmembrane glycoprotein in the CD28 family of T cell costimulatory molecules. This protein is a third inhibitory receptor on T lymphocytes with similarities to cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) and programmed death 1 (PD-1). Unlike other CD28 family members, the BTLA Ig domain in the ECD is of the I-type rather than V-type, and BTLA does not form homodimers. It is also unusual in its interaction with the TNF superfamily member HVEM rather than with B7 family ligands. And, it is a ligand for tumor necrosis factor (receptor) superfamily, member 14 (TNFRSF14), also known as herpes virus entry mediator (HVEM). BTLA-HVEM complexes negatively regulate T-cell immune responses.
AA Sequence
<DGSM>EKATKRNDEECEVQLNIKRNSKHSAWTGELFKIECPVKYCVHRPNVTWCKHNGTIWVPLEVGPQLYTSWEENRSVPVFVLHFKPIHLSDNGSYSCSTNFNSQVINSHSVTIHVRERTQNSSEHPLIISDIPDATNASGPSTMEKRPG<LEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGKHHHHHH>
