Product Overview
Recombinant mouse CD200, fused to hIgG-His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Description
CD200, also known as OX-2 membrane glycoprotein isoform 1, is one of the immunoglobulin superfamily. It plays an important role in anti-tumor immunity through interaction with its receptor, and overexpression of this protein effects on malignancies as well as on cancer stem cells. In T cells, this protein functions as a costimulatory effect that is independent of the CD28 pathway. It also plays an important role on myeloid cell regulation that is suggested by restricted expression of its receptor. Studies of this protein in mouse and rat suggest that this gene may regulate myeloid cell activity and delivers an inhibitory signal for the macrophage lineage in diverse tissues.
AA Sequence
QVEVVTQDERKALHTTASLRCSLKTSQEPLIVTWQKKKAVSPENMVTYSKTHGVVIQPAYKDRINVTELGLWNSSITFWNTTLEDEGCYMCLFNTFGSQKVSGTACLTLYVQPIVHLHYNYFEDHLNITCSATARPAPAISWKGTGTGIENSTESHFHSNGTTSVTSILRVKDPKTQVGKEVICQVLYLGNVIDYKQSLDKG<LEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLM><ISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQD><WLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGF><YPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEAL><HNHYTQKSLSLSPGKHHHHHH>