IMP-7436

CD3E

Purified recombinant protein of Mouse CD3 antigen, epsilon polypeptide (Cd3e), with C-terminal Myc/DDK tag, expressed in HEK293T cells.

Part of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. In addition of this role of signal transduction in T-cell activation, CD3E plays an essential role in correct T-cell development (PubMed: 19956738, PubMed: 24899501). Participates also in internalization and cell surface down-regulation of TCR-CD3 complexes via endocytosis sequences present in CD3E cytosolic region.[UniProtKB/Swiss-Prot Function]

HEK293T

Mouse

C-Myc/DDK

25mM Tris.HCl, pH 7.3, 100mM glycine, 10% glycerol

21.4 kDa

MRWNTFWGILCLSLLAVGTCQDDAENIEYKVSISGTSVELTCPLDSDENLKWEKNGQELPQKHDKHLVLQDFSEVEDSGYYVCYTPASNKNTYLYLKARVCEYCVEVDLTAVAIIIIVDICITLGLLMVIYYWSKNRKAKAKPVTRGTGAGSRPRGQNKERPPPVPNPDYEPIRKGQRDLYSGLNQRAVTRTRPLEQKLISEEDLAANDILDYKDDDDKV

> 80% as determined by SDS-PAGE and Coomassie blue staining.

Store at -80 centigrade after receiving vials.
Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

> 50 μg/mL as determined by microplate BCA method.