Product Overview
Recombinant mouse Ctss, fused to His-tag at C-terminus, was expressed in insect cell and purified by using conventional chromatography techniques.
Description
Ctss, as known as cathepsin S isoform 2, is a lysosomal cysteine protease of the papain family. This protein plays a major role in the processing of the MHC class II-associated invariant chain. It has been implicated in the pathogenensis of several diseases such as Alzheimer s disease and degenerative disorders associated with the cells of the mononuclear phagocytic system. Also, it is less abundant in tissues than Cathepsins B, L and H. The highest levels of this protein have been found in lymph nodes, spleen and phagocytic cells.
AA Sequence
EQLQRDPTLDYHWDLWKKTHEKEYKDKNEEEVRRLIWEKNLKFIMIHNLEYSMGMHTYQVGMNDMGDMTNEEISCRMGALRISRQSPKTVTFRSYSNRTLPDTVDWREKGCVTEVKYQGSCGACWAFSAVGALEGQLKLKTGKLISLSAQNLVDCSNEEKYGNKGCGGGYMTEAFQYIIDNGGIEADASYPYKAMDEKCHYNSKNRAATCSRYIQLPFGDEDALKEAVATKGPVSVGIDASHSSFFFYKSGVYDDPSCTGNVNHGVLVVGYGTLDGKDYWLVKNSWGLNFGDQGYIRMARNNKNHCGIASYCSYPEI<LEHHHHHH>
