IMP-7568

Fcer1g

Purified recombinant protein of Mouse Fc receptor, IgE, high affinity I, gamma polypeptide (Fcer1g), with C-terminal Myc/DDK tag, expressed in HEK293T cells.

Adapter protein containing an immunoreceptor tyrosine-based activation motif (ITAM) that transduces activation signals from various immunoreceptors. As a component of the high-affinity immunoglobulin E (IgE) receptor, mediates allergic inflammatory signaling in mast cells (PubMed: 14764707). As a constitutive component of interleukin-3 receptor complex, selectively mediates interleukin 4/IL4 production by basophils, priming T-cells toward effector T-helper 2 subset (PubMed: 19098920). Associates with pattern recognition receptors CLEC4D and CLEC4E to form a functional signaling complex in myeloid cells. Binding of mycobacterial trehalose 6, 6'-dimycolate (TDM) to this receptor complex leads to phosphorylation of ITAM, triggering activation of SYK, CARD9 and NF-kappa-B, consequently driving maturation of antigen-presenting cells and shaping antigen-specific priming of T-cells toward effector T-helper 1 and T-helper 17 cell subtypes (PubMed: 23602766) (Probable). May function cooperatively with other activating receptors. Functionally linked to integrin beta-2/ITGB2-mediated neutrophil activation (PubMed: 17086186). Also involved in integrin alpha-2/ITGA2-mediated platelet activation (PubMed: 9171347).[UniProtKB/Swiss-Prot Function]

HEK293T

Mouse

C-Myc/DDK

25mM Tris.HCl, pH 7.3, 100mM glycine, 10% glycerol

9.7 kDa

MISAVILFLLLLVEQAAALGEPQLCYILDAVLFLYGIVLTLLYCRLKIQVRKAAIASREKADAVYTGLNTRSQETYETLKHEKPPQTRTRPLEQKLISEEDLAANDILDYKDDDDKV

> 80% as determined by SDS-PAGE and Coomassie blue staining.

Store at -80 centigrade after receiving vials.
Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

> 50 μg/mL as determined by microplate BCA method.