IMP-7056

Fcgr4

Purified recombinant protein of Mouse Fc receptor, IgG, low affinity IV (Fcgr4), with C-terminal Myc/DDK tag, expressed in HEK293T cells.

Receptor for the Fc region of immunoglobulin gamma (PubMed: 16039578). Also acts as a receptor for the Fc region of immunoglobulin epsilon (PubMed: 17558411, PubMed: 18949059). Binds with intermediate affinity to both IgG2a and IgG2b (PubMed: 16039578, PubMed: 17558411, PubMed: 19795417). Can bind to IgG2a and IgG2b monomers (PubMed: 18949059). Does not display binding to IgG1 or IgG3 (PubMed: 16039578). Mediates neutrophil activation by IgG complexes redundantly with Fcgr3 (PubMed: 18097064). Plays a role in promoting bone resorption by enhancing osteoclast differentiation following binding to IgG2a (PubMed: 25824719). Binds with low affinity to both the a and b allotypes of IgE (PubMed: 18949059). Has also been shown to bind to IgE allotype a only but not to allotype b (PubMed: 17558411). Binds aggregated IgE but not the monomeric form and bound monomeric IgG is readily displaced by IgE complexes (PubMed: 18949059). Binding to IgE promotes macrophage-mediated phagocytosis, antigen presentation to T cells, production of proinflammatory cytokines and the late phase of cutaneous allergic reactions (PubMed: 17558411, PubMed: 18949059).[UniProtKB/Swiss-Prot Function]

HEK293T

Mouse

C-Myc/DDK

25mM Tris.HCl, pH 7.3, 100mM glycine, 10% glycerol

28.8 kDa

MWQLLLPTALVLTAFSGIQAGLQKAVVNLDPKWVRVLEEDSVTLRCQGTFSPEDNSIKWFHNESLIPHQDANYVIQSARVKDSGMYRCQTALSTISDPVQLEVHMGWLLLQTTKWLFQEGDPIHLRCHSWQNRPVRKVTYSQNGKGKKYFHENSELLIPKATHNDSGSYFCRGLIGHNNKSSASFRISLGDPGSPSMFPPWHQITFCLLIGLLFAIDTVLYFSVRRGLQSPVADYEEPKIQWSKEPQDKTRTRPLEQKLISEEDLAANDILDYKDDDDKV

> 80% as determined by SDS-PAGE and Coomassie blue staining.

Store at -80 centigrade after receiving vials.
Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

> 50 μg/mL as determined by microplate BCA method.