Recombinant Mouse Il1f8 Protein, C-Myc/DDK-tagged
Product Description
Cat
IMP-7115
Official Symbol
Il1f8
Product Overview
Purified recombinant protein of Mouse interleukin 1 family, member 8 (Il1f8), with C-terminal Myc/DDK tag, expressed in HEK293T cells.
Description
Cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells linked to a pro-inflammatory response. Part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Stimulates production of interleukin-6 and interleukin-8 in synovial fibrobasts, articular chondrocytes and mature adipocytes. Induces expression of a number of antimicrobial peptides including beta-defensin 4 and beta-defensin 103 as well as a number of matrix metalloproteases (By similarity). Seems to be involved in skin inflammatory response by acting on keratinocytes, dendritic cells and indirectly on T-cells to drive tissue infiltration, cell maturation and cell proliferation. Induces the production of proinflammatory cytokines in bone marrow-derived dendritic cells (BMDCs), including IL-12, Il-1 beta, IL-6, TNF-alpha and IL-23, and activates p38 MAPK phosphorylation in BMDCs. Involved in dendritic cell maturation by stimulating the surface expression of CD80, CD86 and MHC class II. Induces the production of IFN-gamma, IL-4 and IL-17 by T-helper 1 (Th1) cells, cultured CD4(+) T-cells and splenocytes.[UniProtKB/Swiss-Prot Function]
Expression System
HEK293T
Species
Mouse
Tag
C-Myc/DDK
Form
25mM Tris.HCl, pH 7.3, 100mM glycine, 10% glycerol
Molecular Mass
21.3 kDa
AA Sequence
MMAFPPQSCVHVLPPKSIQMWEPNHNTMHGSSQSPRNYRVHDSQQMVWVLTGNTLTAVPASNNVKPVILSLIACRDTEFQDVKKGNLVFLGIKNRNLCFCCVEMEGKPTLQLKEVDIMNLYKERKAQKAFLFYHGIEGSTSVFQSVLYPGWFIATSSIERQTIILTHQRGKLVNTNFYIESEKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity
> 80% as determined by SDS-PAGE and Coomassie blue staining.
Storage
Store at -80 centigrade after receiving vials.
Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Concentration
> 50 μg/mL as determined by microplate BCA method.
Data Sheet MSDS
For research or industrial raw materials, not for personal medical use!

Online Inquiry
Contact Info