IMP-7264

SLPI

Purified recombinant protein of Mouse secretory leukocyte peptidase inhibitor (Slpi), with C-terminal Myc/DDK tag, expressed in HEK293T cells.

Acid-stable proteinase inhibitor with strong affinities for trypsin, chymotrypsin, elastase, and cathepsin G (PubMed: 9126337). Modulates the innate immune response after bacterial infection (PubMed: 12615907). Contributes to regulate the inflammatory and immune responses to the intracellular parasite L.major (PubMed: 25030421). Down-regulates responses to bacterial lipopolysaccharide (LPS) (PubMed: 9039268, PubMed: 12615907, PubMed: 25030421). Plays a role in regulating the activation of NF-kappa-B and inflammatory responses (PubMed: 11017147, PubMed: 12615907). Has antimicrobial activity against mycobacteria, but not against salmonella (PubMed: 18322212). Contributes to normal resistance against infection by M.tuberculosis (PubMed: 18322212). Required for normal resistance to L.major (PubMed: 25030421). Required for normal wound healing, probably by preventing tissue damage by limiting protease activity (PubMed: 11017147, PubMed: 25030421). Together with ELANE, required for normal differentiation and proliferation of bone marrow myeloid cells (By similarity).[UniProtKB/Swiss-Prot Function]

HEK293T

Mouse

C-Myc/DDK

25mM Tris.HCl, pH 7.3, 100mM glycine, 10% glycerol

14.3 kDa

MKSCGLLPFTVLLALGILAPWTVEGGKNDAIKIGACPAKKPAQCLKLEKPQCRTDWECPGKQRCCQDACGSKCVNPVPIRKPVWRKPGRCVKTQARCMMLNPPNVCQRDGQCDGKYKCCEGICGKVCLPPMTRTRPLEQKLISEEDLAANDILDYKDDDDKV

> 80% as determined by SDS-PAGE and Coomassie blue staining.

Store at -80 centigrade after receiving vials.
Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.

> 50 μg/mL as determined by microplate BCA method.